Protein or peptide name:	Sda
Chromosome:	subtilis str. 168 complete genome
Protein or peptide start site:	2647596
Protein or peptide end site:	2647456
ncRNA start site:	2647456
ncRNA end site:	2647614
Genome Browser:	NA
Protein or peptide sequence:	MRKLSDELLIESYFKATEMNLNRDFIELIENEIKRRSLGHIISVSS
Protein or peptide length:	46aa
ncRNA type:	ncRNA
ncRNA name:	sda
Entrez ID:	2914223
Experimental species:	Bacillus subtilis subsp. subtilis str. 168
Experimental techniques:	X-ray
Experimental sample (cell line and/or tissue):	Bacillus subtiiis
Description:	The cytosolic 46-amino acid Sda protein, one of the best characterized small proteins, similarly inhibits the first kinase in the histidine kinase phosphorelay that regulates sporulation-specific genes in B. subtilis.
Subcellular location:	NA
Function:	The cytosolic 46-amino acid Sda protein, one of the best characterized small proteins, similarly inhibits the first kinase in the histidine kinase phosphorelay that regulates sporulation-specific genes in B. subtilis.
Title of paper:	Structure of the sporulation histidine kinase inhibitor Sda from Bacillus subtilis and insights into its solution state
PMID:	19465772
Year of publication:	2009